PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013596589.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 269aa    MW: 30307.8 Da    PI: 6.9233
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013596589.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.61.9e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l++ +   G  +W++ ++  g++R++k+c++rw +yl
   XP_013596589.1 14 KGPWTTEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.52.4e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      + +E++l +d+++ lG++ W++Ia++++ gRt++++k++w+++
   XP_013596589.1  71 SHDEEQLVIDLHAHLGNK-WSKIASRLP-GRTDNEIKNHWNTH 111
                      789***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-21562IPR009057Homeodomain-like
PROSITE profilePS5129412.808961IPR017930Myb domain
SuperFamilySSF466892.65E-2612108IPR009057Homeodomain-like
SMARTSM007171.4E-111363IPR001005SANT/Myb domain
PfamPF002496.4E-141461IPR001005SANT/Myb domain
CDDcd001679.62E-91661No hitNo description
PROSITE profilePS5129427.37162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2463117IPR009057Homeodomain-like
SMARTSM007173.8E-1466114IPR001005SANT/Myb domain
CDDcd001675.81E-1171112No hitNo description
PfamPF002491.2E-1471111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGRQPCCDKL EVKKGPWTTE EDKKLINFIL TNGHCCWRAL PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SHDEEQLVID LHAHLGNKWS KIASRLPGRT DNEIKNHWNT HIKKKLVKMG  120
IDPVTHQPLN QEPNNTDNPK SSSSTSDNIL MEPKSRSSKN VQTNSTTTEE ESSSTATGQN  180
SSINNENQLL SNITNDEELF SYLWSDDTAK ADASRSCSNY YGVGGTLYNE DNIPGAGADF  240
PIWSPERVGG KDLMFLDYCQ DFGVHDFGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596589.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX62e-88ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0D3DFF80.0A0A0D3DFF8_BRAOL; Uncharacterized protein
STRINGBra019368.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.11e-148myb domain protein 85